PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.007G353000.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bHLH
Protein Properties Length: 257aa    MW: 28805.9 Da    PI: 6.3055
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.007G353000.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH36.49.6e-1269121155
                         CHHHHHHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHHH CS
                 HLH   1 rrrahnerErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksLq 55 
                         ++ +hn+ E  RR+++N+ ++ Lr++lP++  ++ k+ls  +++ +  +YI +Lq
  Gorai.007G353000.1  69 KKLNHNASECVRRRKMNDLYSSLRSMLPPS--EQTKRLSIPATVSRMLKYIPELQ 121
                         6789*************************7..36666***************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd000831.79E-1067125No hitNo description
SuperFamilySSF474591.83E-1267135IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PROSITE profilePS5088813.1668120IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000109.6E-969121IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.102.5E-869134IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SMARTSM003534.1E-574126IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 257 aa     Download sequence    Send to blast
MCALFPVCEW PLDAPIGHQH IISGAFAGFE SFDDFHHFTF PDDLPRIQLD RPMLSAGDTG  60
DENPTTVEKK LNHNASECVR RRKMNDLYSS LRSMLPPSEQ TKRLSIPATV SRMLKYIPEL  120
QLQVEILLQK KQQILSTICK QDDHDLSNQH HQNKTKLSDG FKVSPFTVSG TKVTDTEATI  180
QISTFGPTSQ GIPPLSPILR GLEEDGLFLT DASCFESFGG RVFYNLNFQV ETTYNLEAML  240
LVLNEKLLSL YKKGKA*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX5820211e-72JX582021.1 Gossypium hirsutum clone NBRI_GE14786 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012434882.10.0PREDICTED: transcription factor ORG2-like isoform X1
TrEMBLA0A0D2PJI41e-109A0A0D2PJI4_G
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM48228153
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56970.13e-45bHLH family protein